top of page

Imine Reductase (Arabidopsis thaliana), p-IR14

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Arabidopsis thaliana) Sarah L. Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPLLLRRFPSPSVVSSFFLRRSMASSTISSDIITPSNTKIGWIGTGVMGRSMCGHLIKAGYTVTVFNRTISKAQTLIDMGANVADSPNSVAEQSDVVFTIVGYPSDVRHVLLDPKSGALSGLRQGGVLVDMTTSEPSLAEEIAKAASFKNCFSIDAPVSGGDLGAKNGKLSIFAGGDETTVKRLDPLFSLMGKVNFMGTSGKGQFAKLANQITIASTMLG
    LVEGLIYAHKAGLDVKKFLEAISTGAAGSKSIDLYGDRILKRDFDPGFYVNHFVKDLGICLNECQRMGLALPGLALAQQLYLSLKAHGEGDLGTQALLLALERLNNVSVQSSDS

    Uniprot ID

    3HID1_ARATH

bottom of page