top of page

Imine Reductase (Arabis alpina), p-IR10

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Arabis alpina) Sarah L. Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPLLLRRYLSPSVVSSSFLRRSMAYSSISTDPINPSYSSISTDPINPSNTKIGWIGTGVMGRSMCGHLIRAGYSVTVFNRTISKAQTLLDMGAKLADSPSSVASQSDVVFSIVGYPSDVRNVLLDPNSGALSGLRKGGVLVDMTTSEPSLAEEIAKSASSVHCFSIDAPVSGGDLGAKNGKLSIFTGGDETTVKRLDPLFSLMGKVNFMGTSGKGQFAKL
    GNQITIASTMLGLVEGIIYAHKSGLDVKKFLEAISTGAAGSKSIDLYGDRIMKRDFDPGFYVNHFVKDLGICLNECQRMGLALPGLALAQQLYLSLKAHGQGDLGTQALILALERLNNVKIDFY

    Uniprot ID

    A0A087GHW2_ARAAL

bottom of page