top of page

Imine Reductase (Brassica rapa subsp. pekinensis), p-IR18

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Brassica rapa) Sarah L. Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPLLLRRPLSPSVVSSFFLRRRSMSSKSDPISPSNTRIGWIGTGVMGRSMCGHLIKAGYSVTVFNRTISKAQPLLAMGANLAASPNSLASQSDVVFSIVGYPSDVRRVLLDPTSGALSGLSPGGVLVDMTTSEPSLAEEISKSASSAGCFSVDAPVSGGDLGAKNGKLSIFAGGDEATVKRLDPLFRLMGKVNFMGASGKGQFAKLANQITIASTMVGLVEGIVYAHKAGLDVRKFLEAISTGAAGSKSIDLYGERILKRDFDPGFYVDHFVKDLGICLNECQRMGLALPGLALAQQLYLSLKAHGEGGLGTQALILALERLNNVSVQPSVS

    Uniprot ID

    M4DQA1_BRARP

bottom of page