top of page

Imine Reductase (Cucumis sativus), p-IR26

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Cucumis sativus) Sarah L Montgomery et all. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPIQFSLRSLYTQSHKLTPTLSLPFLSFLRRTMSTSGDIVSPSTTRVGWIGTGVMGCSMCSHIIKAGYKLTVFNRTISKAQPLLDLGANLATSPLAVAAQSDVVFSIVGYPSDVRSVLLDPSSGALAGLRPGGVLIDMTTSEPSLASEIAASATAKGCGAIDAPVSGGDRGAKNATLAIFAGGDEDEVQRLSPLFSLLGKVNYMGESGKGQFAKLANQITIASTMVGLVEGMIYAKKAGLDVGLFLNAISTGAAGSKSLDLYGSRILKRDFEPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYVSLKAYGEGNLGTQALILSLERLNNVSLEGSGSS

    Uniprot ID

    A0A0A0LIQ8_CUCSA

bottom of page