top of page

Imine Reductase (Daucus carota subsp. sativus), p-IR27

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Daucus carota) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMSSITTAEPRSPSNTRLGWIGTGVMGLSMCSHLLKAGYTLTVFTRTQSKAQPLLDLGAKWAASPSSVASQSDVVFSIVGYPSDVRHVTLHPNSGALSGLNPGGILVDMTTSDPSLAVEIADAAAAKGCFSVDAPVSGGDRGARNGSLSIFAGGDKKVIDTLSPLFNLLGKVNYMGVSGKGQFAKLGNQITIASTMVGLIEGMMFAHKAGLDLSLFINAISTGAAGSKSLELYGYRILKRDFEAGFFVNHFVKDLGICLRECQNMGIALPGLALAQQLYVSLQAHGEGDLGTQALVLALERLNNVSLQSVASSTEMA

    Uniprot ID

    A0A161WTE2_DAUCA

bottom of page