top of page

Imine Reductase (Eutrema salsugineu), p-IR34

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Eutrema salsugineu) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMASKSISSVPINPSNTRIGWIGTGVMGRSMCGHLIRAGYSVTVFNRTVSKAQTLIDMGAKLADSPNSLAAQSDVVFSIVGYPSDVRHVLLDPISGALSGLNPGGVLVDMTTSEPSLAEEISKAASSANCFSIDAPVSGGDLGAKNGKLAIFAGGDETTVKRLDPLFSLMGKVNFMGTSGKGQFAKLANQITIASTMLGLVEGMIYAHKSGLDVKKFLKAISTGAAGSKSIDLYGDRILKRDFDPGFYVNHFVKDLGICLKECQRMGLALPGLAIAQQLYLSLKAHGEGDLGTQALILSLERLNNVSVQPIM

    Uniprot ID

    V4KLI0_EUTSA

bottom of page