top of page

Imine Reductase (Gossypium hisutum), p-IR38

 

From publication 

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Gossypium hisutum) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMRSLSYLLGSLSRYFPHSQSSSTPHLTFLLRSMATSAAAGPINPSNTRLGWIGTGVMGRSMCAHLINAGYSLTVFNRTLSKAQPLVDMGARLAQTPHDLAAQSDVVFSIVGYPSDVLQVLLDPVNGALSGLRPGGILVDMTTSEPSLAVEISTAASSKNCSSIDAPVSGGDRGAKNGTLAIFAGGDEAIVNRLNPIFTLMGKVNYMGPSGKGQFAKLANQITIASTMVGLVEGIIYAHKAGLNVASFLDAISTGAAGSKSLDLYGSRILKRDFDPGFFVNHFVKDLGICLKECQNMGLALPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNATLGS

    Uniprot ID

    A0A1U8PU55_GOSHI

bottom of page