top of page

Imine Reductase (Lupinus angustifolius), p-IR46

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Lupinus angustifolius) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMASSTAAEPISPSNTRLGWIGTGVMGQSMCAHLIRAGYTLTVFNRTPSKAQPLLDLGAHQAHSPQALASQSDVVFSIVGYPSDVRSVLLDPTSGVLSGLLPGGILVDMTTSEPSLAVEIAAAAAEKNCHSVDAPVSGGDRGAKNGTLAIFAGGDKDTVHRLEPLFSLLGKVNYMGGSGKGQFAKLANQITIASTMVGLVEGMVYAHKAGLDVGLWLDAISTGAAGSKSLDLYGQRILKRDLDPGFYVNHFVKDLGICLKECQNMGIALPGLALAQQLYVSLKAHGEGNLGTQALILVLERLNNVSLAPAASSS

    Uniprot ID

    A0A1J7FZG6_LUPAN

bottom of page