top of page

Imine Reductase (Medicago truncatula), p-IR54

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Medicago truncatula) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPLPFLRFRSLYRHSHTHLLTRHFMATSEPITPSNTRLGWIGTGVMGQSMCAHLIRSGYTLTVFNRTPSKAQPLLDIGATLATSPHAVASQSDVVFSIVGYPSDVRSVLLDPNTGALAGLKSGGILVDMTTSDPSLAVEIADAASVKSCHSIDAPVSGGDRGAKNGTLAIFAGGDESIVKKLSPLFSSLGKVNYMGTSGKGQFVKLANQITIASTMVGLVEGMVYAHKAGLDVGLYLDAISTGAAGSKSLELYGKRILKRDFEAGFYVNHFVKDLGICLKECEKMGIALPGLALAQQLYVSLKAHGEGNLGTQALILVLERLNNVSLPPSVI

    Uniprot ID

    G7L7F1_MEDTR

bottom of page