top of page

Imine Reductase (Morus notabilis), p-IR51

 

From publication

DOI: 10.1126/sciadv.aay9320

 

Imine Reductase (Morus notabilis) Sarah L Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMPLSLPLRSLSSHHSSFNISSLSLRLLTHLHRSMATAAAAEPTICPSNTRVGWIGTGVMGRSMCAHLINAGYTLTVFNRTLSKAQPLLDMGAHLAHSPLAVASQSDVVFSIVGFPSDVRSVLLDPSSGTLAGLRPGGVLVDMTTSEPSLAAEISSAAASKGCSSIDAPVSGGDRGAKNGTLAIFAGGEESVIHRLNPLFSLLGKVNYMGGPGRGQFAKLANQITIASTMVGLVEGMIYAHKAGLDVAMFLDAISTGAAGSKSLDLYGARILKRDFEPGFFVNHFVKDLGICLKECQNLGLGLPGLALAQQLYLSLKAHGEGNLGTQALILALERLNNVSLESGGCSSSPAPAN

    Uniprot ID

    W9T391_9ROSA

bottom of page