top of page

Imine Reductase (Penicillium camemberti), p-IR63, PcIRED

 

From publication

doi.org/10.1021/jacs.8b11891

 

Imine Reductase (Penicillium camemberti) Wojciech Zawodny et al. (2018)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMSTSEPKSISILGLGQMGHAIASNFVSQGFKTFVWNRTPSKAADLVEQGAIQSPSSTECIRSSPLSILCVNTDDIVMDILAAAGDIPGHTIVNIVNGSPQQVRKTAEKSISQYMAAGYLHGSVMASPGLVRSGGAMTIFAGSSETFKKWELTLQPLGVTLWLLDDVGAAPLYDCSLLSILSGIFSGFMQALAMIGAAGHSETEFARGFVVPLLGQMEEWLVRTAEEVQNKDYVAEKNGSPIAVQLDSTKHIFETAKELGVSSRLLQGFLDVVKEGVQRGQGREEISGLVRLLREPK

    Uniprot ID

    A0A0G4PFF8_PENCA

bottom of page