top of page

Imine Reductase (Picea sitchensis), p-IR66

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Picea sitchensis) Sarah L Montgomery et al (2020)

£250.00Price
  • Protein sequence

    MGSSHHHHHHSSGLVPRGSHMAAEKPRVGWIGTGVMGQAMCGHILSAGYSVTVFNRTLSKAQTLCDRGAIMVDSPKSVAAESDIVFTIVGYPQDVREVIIGENGVLQGLKPGGTVVDMTTSEPSLAREIIDYAKQRGCESVDAPVSGGDKGAKAGALAIFAGGEETVVEGLKPLFDCMGKVTYMGGPGLGQCTKLGNQITIASTMVGLVEGMVYAHKAGLDVEMYIKAISAGAAGSRSLDLYADRILRRDFDPGFFVNHFVKDLGISLRECQQMGLSLPGLALAQQLYVSLKAHGEGNLGTQALVLALERLNNVQLPKIG

    Uniprot ID

    A9NZ37_PICSI

bottom of page