top of page

Imine Reductase (Pochonia chlamydosporia), p-IR62

 

From publication

DOI: 10.1126/sciadv.aay9320

Imine Reductase (Pochonia chlamydosporia) Sarah L. Montgomery et al. (2020)

£250.00Price
  • Protein sequence

    >PRO-LIT(030) p-IR62 Pochonia chlamydosporia
    MGSSHHHHHHSSGLVPRGSHMSSEQTVSVLGLGLMGSALAKALVQNGWKTTVWNRSPEKA
    QPLVELGASASTTAADCVRASRVIITCVMDPAALQGILKTLTQEDCKGRILVDYTSGVPS
    EMRKCEDQALALSLKYFHGAILTMPSLIGMSTSTLLHSGADEITFESINPVLKAFGQSIY
    LGQDASWATLQEGILGCCFYGFAGGFVQAMALLKSSSFYVPGGAQTLMSQGILPLLTEQF
    PHIFADLARQIDEQAYDSEGNGIRLDTLKSSLEQLIRVNSEQGLVSNAFDPMLSLLKARI
    AQGGAAEEMSGLVEAISNPPKQT

    Uniprot ID

    A0A179G8F8_METCM

bottom of page